Recombinant Human FAHD1 Protein, GST-tagged
Cat.No. : | FAHD1-3651H |
Product Overview : | Human FAHD1 full-length ORF ( AAH20615.1, 1 a.a. - 47 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | FAHD1 (Fumarylacetoacetate Hydrolase Domain Containing 1) is a Protein Coding gene. Among its related pathways are Tyrosine metabolism and Metabolism. GO annotations related to this gene include oxaloacetate decarboxylase activity and fumarylpyruvate hydrolase activity. An important paralog of this gene is FAHD2A. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MFQITFRCLPNFLRFGHHQEAFVKIKISTNYWPISDLLNQFDRINLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | FAHD1 fumarylacetoacetate hydrolase domain containing 1 [ Homo sapiens ] |
Official Symbol : | FAHD1 |
Synonyms : | FAHD1; fumarylacetoacetate hydrolase domain containing 1; C16orf36, chromosome 16 open reading frame 36; acylpyruvase FAHD1, mitochondrial; DKFZP566J2046; YISK like/RJD15; yisK-like protein; fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; C16orf36; MGC74876; DKFZp566J2046; |
Gene ID : | 81889 |
mRNA Refseq : | NM_001018104 |
Protein Refseq : | NP_001018114 |
MIM : | 616320 |
UniProt ID : | Q6P587 |
Products Types
◆ Recombinant Protein | ||
FAHD1-1141H | Recombinant Human FAHD1 Protein, MYC/DDK-tagged | +Inquiry |
FAHD1-1855R | Recombinant Rat FAHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAHD1-2938M | Recombinant Mouse FAHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fahd1-2907M | Recombinant Mouse Fahd1 Protein, Myc/DDK-tagged | +Inquiry |
FAHD1-1369R | Recombinant Rhesus Macaque FAHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
FAHD1-250HCL | Recombinant Human FAHD1 lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket