Recombinant Human FCER1G Protein (45-86 aa), His-tagged
Cat.No. : | FCER1G-1395H |
Product Overview : | Recombinant Human FCER1G Protein (45-86 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Description : | Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin. |
Source : | Yeast |
Species : | Human |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 6.9 kDa |
Protein length : | 45-86 aa |
AA Sequence : | RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name : | FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ] |
Official Symbol : | FCER1G |
Synonyms : | FCER1G; fcRgamma; fceRI gamma; FCRG; |
Gene ID : | 2207 |
mRNA Refseq : | NM_004106 |
Protein Refseq : | NP_004097 |
MIM : | 147139 |
UniProt ID : | P30273 |
Products Types
◆ Recombinant Protein | ||
FCER1G-3182M | Recombinant Mouse FCER1G Protein, His (Fc)-Avi-tagged | +Inquiry |
Fcer1g-1026M | Recombinant Mouse Fcer1g Protein, MYC/DDK-tagged | +Inquiry |
FCER1G-12816H | Recombinant Human FCER1G, GST-tagged | +Inquiry |
FCER1G-3713C | Recombinant Chicken FCER1G | +Inquiry |
FCER1G-2891H | Recombinant Human FCER1G protein, His-B2M-tagged | +Inquiry |
◆ Lysates | ||
FCER1G-6281HCL | Recombinant Human FCER1G 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket