Recombinant Human FCGR2B protein, Myc/DDK-tagged

• Cat.No.: FCGR2B-02H
• Product Overview: Recombinant Human FCGR2B protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: ES Cell Differentiation/IPS, Transmembrane. Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus.

Specification

• Description: The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293T
• Species: Human
• Tag: Myc/DDK
• Form: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 33.8 kDa
• AA Sequence: myc-FLAG tag
• Product-Related Proteins: TA50011-100
  LC400365
  TA349972
  C204496
• Purity: > 80%
• Usage: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL

Gene Information

• Gene Name: FCGR2B Fc gamma receptor IIb [ Homo sapiens (human) ]
• Official Symbol: FCGR2B
• Synonyms: CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2
• Gene ID: 2213
• mRNA Refseq: NM_001002275
• Protein Refseq: NP_001002275
• MIM: 604590
• UniProt ID: P31994