Recombinant Human FCGRT protein, Myc/DDK-tagged

• Cat.No.: FCGRT-01H
• Product Overview: Recombinant Human FCGRT protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Transmembrane.

Specification

• Description: This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
• Source: HEK293T
• Species: Human
• Tag: Myc/DDK
• Form: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 39.6 kDa
• AA Sequence: myc-FLAG tag
• Product-Related Proteins: TA50011-100
  LC427768
  RC227329
• Purity: > 80%
• Usage: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL

Gene Information

• Gene Name: FCGRT Fc gamma receptor and transporter [ Homo sapiens (human) ]
• Official Symbol: FCGRT
• Synonyms: alpha-chain; FCRN
• Gene ID: 2217
• mRNA Refseq: NM_001136019
• Protein Refseq: NP_001129491
• MIM: 601437
• UniProt ID: P55899