Recombinant Human FOXO1, His-tagged
Cat.No. : | FOXO1-28946TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 277-655 of Human FOXO1A with N terminal His tag; 379 amino acids, 49kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 151 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPR TSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAK MASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSS PGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMS PLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDS PPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQ ASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPH TSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNG YGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGD TLDFNFDNVLPNQSFPHSVKTTTHSWVSG |
Sequence Similarities : | Contains 1 fork-head DNA-binding domain. |
Gene Name : | FOXO1 forkhead box O1 [ Homo sapiens ] |
Official Symbol : | FOXO1 |
Synonyms : | FOXO1; forkhead box O1; FKHR, forkhead homolog in rhabdomyosarcoma , FOXO1A; forkhead box protein O1; FKH1; |
Gene ID : | 2308 |
mRNA Refseq : | NM_002015 |
Protein Refseq : | NP_002006 |
MIM : | 136533 |
Uniprot ID : | Q12778 |
Chromosome Location : | 13q14.1 |
Pathway : | AKT phosphorylates targets in the nucleus, organism-specific biosystem; AKT-mediated inactivation of FOXO1A, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; |
Function : | DNA bending activity; double-stranded DNA binding; protein binding; protein kinase binding; sequence-specific DNA binding; |
Products Types
◆ Recombinant Protein | ||
FOXO1-3334M | Recombinant Mouse FOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXO1-935H | Recombinant Human FOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Foxo1-3077M | Recombinant Mouse Foxo1 Protein, Myc/DDK-tagged | +Inquiry |
FOXO1-2043R | Recombinant Rat FOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXO1-4469H | Recombinant Human FOXO1 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket