Recombinant Human FOXP1, His-tagged
Cat.No. : | FOXP1-28111TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 80-427 of Human FOXP1 with N terminal His tag; Predicted MWt 40 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 162 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQ VLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQ LLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQH LLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWK EVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNP HASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWP GCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQ QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVS SVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTT |
Sequence Similarities : | Contains 1 C2H2-type zinc finger.Contains 1 fork-head DNA-binding domain. |
Gene Name : | FOXP1 forkhead box P1 [ Homo sapiens ] |
Official Symbol : | FOXP1 |
Synonyms : | FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1; |
Gene ID : | 27086 |
mRNA Refseq : | NM_001012505 |
Protein Refseq : | NP_001012523 |
MIM : | 605515 |
Uniprot ID : | Q9H334 |
Chromosome Location : | 3p14.1 |
Function : | DNA bending activity; chromatin binding; double-stranded DNA binding; metal ion binding; protein heterodimerization activity; |
Products Types
◆ Recombinant Protein | ||
Foxp1-374M | Recombinant Mouse Foxp1 Protein, MYC/DDK-tagged | +Inquiry |
FOXP1-3337M | Recombinant Mouse FOXP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXP1-2044R | Recombinant Rat FOXP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXP1-509H | Recombinant Human FOXP1 Protein (1-114 aa), GST-tagged | +Inquiry |
FOXP1-1566R | Recombinant Rhesus Macaque FOXP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
FOXP1-6146HCL | Recombinant Human FOXP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket