Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human FPR2 Protein, GST-tagged

Cat.No. : FPR2-4487H
Product Overview : Human FPR2 partial ORF ( AAH29125.1, 163 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : FPR2 (Formyl Peptide Receptor 2) is a Protein Coding gene. Diseases associated with FPR2 include Prion Disease. Among its related pathways are Peptide ligand-binding receptors and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include G-protein coupled receptor activity and N-formyl peptide receptor activity. An important paralog of this gene is FPR3.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 30.36 kDa
AA Sequence : FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : FPR2 formyl peptide receptor 2 [ Homo sapiens ]
Official Symbol : FPR2
Synonyms : FPR2; formyl peptide receptor 2; formyl peptide receptor like 1, FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); FPRH1; FPRL1; FMLP-R-II;
Gene ID : 2358
mRNA Refseq : NM_001005738
Protein Refseq : NP_001005738
MIM : 136538
UniProt ID : P25090

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends