Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GALK2, His-tagged

Cat.No. : GALK2-28969TH
Product Overview : Recombinant fragment, corresponding to amino acids 265-445 of Human GALK2 with N terminal His tag; 191 amino acids, 22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLG ISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVL QFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELD QLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFL ANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLL
Gene Name : GALK2 galactokinase 2 [ Homo sapiens ]
Official Symbol : GALK2
Synonyms : GALK2; galactokinase 2; N-acetylgalactosamine kinase; GK2;
Gene ID : 2585
mRNA Refseq : NM_001001556
Protein Refseq : NP_001001556
MIM : 137028
Uniprot ID : Q01415
Chromosome Location : 15
Pathway : Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : ATP binding; N-acetylgalactosamine kinase activity; galactokinase activity; galactokinase activity; kinase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All GALK2 Products

Required fields are marked with *

My Review for All GALK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends