Recombinant Human GCH1
Cat.No. : | GCH1-28280TH |
Product Overview : | Recombinant full length Human GTP cyclohydrolase 1 with N-terminal proprietary tag.Mol Wt 53.61 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. |
Protein length : | 251 amino acids |
Molecular Weight : | 53.610kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPP RPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILS SLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNK QVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT REEFLTLIRS |
Sequence Similarities : | Belongs to the GTP cyclohydrolase I family. |
Gene Name : | GCH1 GTP cyclohydrolase 1 [ Homo sapiens ] |
Official Symbol : | GCH1 |
Synonyms : | GCH1; GTP cyclohydrolase 1; dystonia 14 , DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1; |
Gene ID : | 2643 |
mRNA Refseq : | NM_000161 |
Protein Refseq : | NP_000152 |
MIM : | 600225 |
Uniprot ID : | P30793 |
Chromosome Location : | 14q22.1-q22.2 |
Pathway : | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem; |
Function : | GTP binding; GTP cyclohydrolase I activity; NOT GTP cyclohydrolase I activity; GTP-dependent protein binding; calcium ion binding; |
Products Types
◆ Recombinant Protein | ||
GCH1-3024H | Recombinant Human GCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCH1-4794H | Recombinant Human GCH1 Protein, GST-tagged | +Inquiry |
GCH1-2197H | Recombinant Human GCH1 Protein, His-tagged | +Inquiry |
GCH1-2145R | Recombinant Rat GCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCH1-3504M | Recombinant Mouse GCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
GCH1-5988HCL | Recombinant Human GCH1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket