Recombinant Human GOLGA2, His-tagged
Cat.No. : | GOLGA2-29029TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 318-617 of Human GM130 with N terminal His tag; 300 amino acids, 63kDa. GenBank: EAW87765.1 |
- Specification
- Gene Information
- Related Products
Description : | The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 121 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | LGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHL QQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQG KAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGE GDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREA MVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLA SAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFM ELMQEKADLKERAREGSPRDNPTAQQIMQLLREMQNPR ERPGLGSNPCIPFFYRADENDEVKITVI |
Sequence Similarities : | Belongs to the GOLGA2 family. |
Gene Name : | GOLGA2 golgin A2 [ Homo sapiens ] |
Official Symbol : | GOLGA2 |
Synonyms : | GOLGA2; golgin A2; golgi autoantigen, golgin subfamily a, 2; Golgin subfamily A member 2; GM130; Golgi matrix protein GM130; golgin 95; SY11 protein; |
Gene ID : | 2801 |
mRNA Refseq : | NM_004486 |
Protein Refseq : | NP_004477 |
MIM : | 602580 |
Uniprot ID : | Q08379 |
Chromosome Location : | 9q34.13 |
Pathway : | PLK1 signaling events, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
GOLGA2-01H | Recombinant Human GOLGA2 Protein, GST-tagged | +Inquiry |
GOLGA2-5105H | Recombinant Human GOLGA2 Protein, GST-tagged | +Inquiry |
GOLGA2-3291H | Recombinant Human GOLGA2 Protein (Ala361-Ala678), N-His tagged | +Inquiry |
GOLGA2-6782Z | Recombinant Zebrafish GOLGA2 | +Inquiry |
◆ Lysates | ||
GOLGA2-726HCL | Recombinant Human GOLGA2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket