Recombinant Human GSTA2
Cat.No. : | GSTA2-27546TH |
Product Overview : | Recombinant Full Length Human GSTA2 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-222; 222 amino acids, 25.6kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. |
Form : | Liquid |
Purity : | Immunogen affinity purified |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAED LDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASK YNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEE QDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLS RADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLP TVKKFLQPGSPRKPPMDEKSLEESRKIFRF |
Gene Name : | GSTA2 glutathione S-transferase alpha 2 [ Homo sapiens ] |
Official Symbol : | GSTA2 |
Synonyms : | GSTA2; glutathione S-transferase alpha 2; glutathione S transferase A2 , GST2; glutathione S-transferase A2; |
Gene ID : | 2939 |
mRNA Refseq : | NM_000846 |
Protein Refseq : | NP_000837 |
MIM : | 138360 |
Uniprot ID : | P09210 |
Chromosome Location : | 6p12.2 |
Pathway : | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; |
Function : | glutathione transferase activity; glutathione transferase activity; transferase activity; |
Products Types
◆ Recombinant Protein | ||
GSTA2-1808R | Recombinant Rhesus Macaque GSTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA2-1029H | Recombinant Human GSTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA2-4410H | Recombinant Human GSTA2 Protein, GST-tagged | +Inquiry |
GSTA2-3967M | Recombinant Mouse GSTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA2-13570H | Recombinant Human GSTA2, GST-tagged | +Inquiry |
◆ Lysates | ||
GSTA2-5718HCL | Recombinant Human GSTA2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket