Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GSTA3, GST-tagged

Cat.No. : GSTA3-27543TH
Product Overview : Recombinant full length Human GSTA3 with N terminal proprietary tag. Predicted MW 50.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined.
Protein length : 222 amino acids
Conjugation : GST
Molecular Weight : 50.530kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAED LGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYN LYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISL VELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF
Sequence Similarities : Belongs to the GST superfamily. Alpha family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name : GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ]
Official Symbol : GSTA3
Synonyms : GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3;
Gene ID : 2940
mRNA Refseq : NM_000847
Protein Refseq : NP_000838
MIM : 605449
Uniprot ID : Q16772
Chromosome Location : 6p12.2
Pathway : Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function : glutathione transferase activity; glutathione transferase activity; glutathione transferase activity; transferase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All GSTA3 Products

Required fields are marked with *

My Review for All GSTA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends