Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GUCA1A

Cat.No. : GUCA1A-28157TH
Product Overview : Recombinant full length Human GCAP1 with a N terminal proprietary tag; Predicted MW 47.52 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.
Protein length : 201 amino acids
Molecular Weight : 47.520kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Retina; cone outer and inner segments, in particular, in disk membrane regions, and to a lesser extent rod inner and outer segments.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFR QFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAAL SLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGV QKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAA G
Sequence Similarities : Contains 4 EF-hand domains.
Gene Name : GUCA1A guanylate cyclase activator 1A (retina) [ Homo sapiens ]
Official Symbol : GUCA1A
Synonyms : GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131 , GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1;
Gene ID : 2978
mRNA Refseq : NM_000409
Protein Refseq : NP_000400
MIM : 600364
Uniprot ID : P43080
Chromosome Location : 6p21.1
Pathway : Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Phototransduction, organism-specific biosystem; Phototransduction, conserved biosystem; Visual signal transduction: Cones, organism-specific biosystem;
Function : calcium ion binding; calcium sensitive guanylate cyclase activator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends