Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GYPB Protein, GST-tagged

Cat.No. : GYPB-4510H
Product Overview : Human GYPB partial ORF (NP_002091.2, 22 a.a. - 59 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5 UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 29.81 kDa
AA Sequence : TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : GYPB glycophorin B (MNS blood group) [ Homo sapiens ]
Official Symbol : GYPB
Synonyms : GYPB; glycophorin B (MNS blood group); glycophorin B (includes Ss blood group) , glycophorin B (Ss blood group) , MNS; glycophorin-B; CD235b; GPB; SS; Ss blood group; glycophorin MiX; glycophorin HeP2; glycophorin MiVI; glycophorin MiIII; sialoglycoprotein delta; SS-active sialoglycoprotein; MNS; PAS-3; GPB.NY; HGpMiX; GpMiIII; HGpMiVI; GYPHe.NY; HGpMiIII;
Gene ID : 2994
mRNA Refseq : NM_002100
Protein Refseq : NP_002091
UniProt ID : P06028

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends