Recombinant Human HIP1R, His-tagged
Cat.No. : | HIP1R-29320TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 729-876 of Human HIP1R with a N terminal His tag; Pred MWt 17kDa: |
- Specification
- Gene Information
- Related Products
Description : | Huntingtin-interacting protein 1-related protein is a protein that in humans is encoded by the HIP1R gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 99 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELK PKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMN QARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSL QKEIVESGRGAATQQEFYAKNSRWTEGLISAS |
Gene Name : | HIP1R huntingtin interacting protein 1 related [ Homo sapiens ] |
Official Symbol : | HIP1R |
Synonyms : | HIP1R; huntingtin interacting protein 1 related; huntingtin-interacting protein 1-related protein; FLJ14000; HIP3; HIP12; ILWEQ; KIAA0655; |
Gene ID : | 9026 |
mRNA Refseq : | NM_003959 |
Protein Refseq : | NP_003950 |
MIM : | 605613 |
Uniprot ID : | O75146 |
Chromosome Location : | 12q24 |
Pathway : | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function : | actin binding; phosphatidylinositol binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
HIP1R-4168M | Recombinant Mouse HIP1R Protein, His (Fc)-Avi-tagged | +Inquiry |
Hip1r-3399M | Recombinant Mouse Hip1r Protein, Myc/DDK-tagged | +Inquiry |
HIP1R-3232H | Recombinant Human HIP1R Protein (Ser771-Ala1012), N-His tagged | +Inquiry |
HIP1R-30H | Recombinant Human HIP1R, MYC/DDK-tagged | +Inquiry |
HIP1R-7857H | Recombinant Human HIP1R protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
HIP1R-789HCL | Recombinant Human HIP1R cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket