Recombinant Human HOXA1

• Cat.No.: HOXA1-28508TH
• Product Overview: Recombinant fragment of Human HOXA1 with N-terminal proprietary tag. Predicted MW 37.62kDa.

Specification

• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region.
• Protein length: 109 amino acids
• Molecular Weight: 37.620kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGD DRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSY SHSSCGPSYGSQNFSAPYSPYALNQEADV
• Sequence Similarities: Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: HOXA1 homeobox A1 [ Homo sapiens ]
• Official Symbol: HOXA1
• Synonyms: HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1
• Gene ID: 3198
• mRNA Refseq: NM_005522
• Protein Refseq: NP_005513
• MIM: 142955
• Uniprot ID: P49639
• Chromosome Location: 7p15.2
• Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity