Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IFIT1

Cat.No. : IFIT1-26949TH
Product Overview : Recombinant fragment of Human IFIT1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Interferon-induced Protein With Tetratricopeptide Repeats 1 is a protein that is encoded by the IFIT1 gene.
Protein length : 103 amino acids
Molecular Weight : 36.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVN AIIHYLKAIKIEQASLTRDKSIN
Sequence Similarities : Belongs to the IFIT family.Contains 10 TPR repeats.
Gene Name : IFIT1 interferon-induced protein with tetratricopeptide repeats 1 [ Homo sapiens ]
Official Symbol : IFIT1
Synonyms : IFIT1; interferon-induced protein with tetratricopeptide repeats 1; G10P1, IFI56, IFNAI1; GARG 16;
Gene ID : 3434
mRNA Refseq : NM_001548
Protein Refseq : NP_001539
MIM : 147690
Uniprot ID : P09914
Chromosome Location : 10q23.31
Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All IFIT1 Products

Required fields are marked with *

My Review for All IFIT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends