Recombinant Human IFIT1
Cat.No. : | IFIT1-26949TH |
Product Overview : | Recombinant fragment of Human IFIT1 with a N terminal proprietary tag: predicted molecular weight 36.96 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Interferon-induced Protein With Tetratricopeptide Repeats 1 is a protein that is encoded by the IFIT1 gene. |
Protein length : | 103 amino acids |
Molecular Weight : | 36.960kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHR KAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVN AIIHYLKAIKIEQASLTRDKSIN |
Sequence Similarities : | Belongs to the IFIT family.Contains 10 TPR repeats. |
Gene Name : | IFIT1 interferon-induced protein with tetratricopeptide repeats 1 [ Homo sapiens ] |
Official Symbol : | IFIT1 |
Synonyms : | IFIT1; interferon-induced protein with tetratricopeptide repeats 1; G10P1, IFI56, IFNAI1; GARG 16; |
Gene ID : | 3434 |
mRNA Refseq : | NM_001548 |
Protein Refseq : | NP_001539 |
MIM : | 147690 |
Uniprot ID : | P09914 |
Chromosome Location : | 10q23.31 |
Pathway : | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
IFIT1-1144H | Recombinant Human IFIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFIT1-4432M | Recombinant Mouse IFIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFIT1-48P | Recombinant P. alecto IFIT1 Protein, His-tagged | +Inquiry |
IFIT1-19H | Recombinant Human IFIT1 Protein, His-tagged | +Inquiry |
IFIT1-8014M | Recombinant Mouse IFIT1 Protein | +Inquiry |
◆ Lysates | ||
IFIT1-5288HCL | Recombinant Human IFIT1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All IFIT1 Products
Required fields are marked with *
My Review for All IFIT1 Products
Required fields are marked with *
0
Inquiry Basket