Recombinant Human IGF2, StrepII-tagged
Cat.No. : | IGF2-212H |
Product Overview : | Purified, full-length human recombinant IGF2 protein (amino acids 93-126, 34 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 4 kDa. (Accession NP_000603.1; UniProt P01344) |
- Specification
- Gene Information
- Related Products
Description : | IGF2 is a member of the insulin family of polypeptide growth factors, which are involved in development and growth. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. |
Source : | Human Cells |
Species : | Human |
Tag : | StrepII |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
Protein length : | 93-126, 34 a.a. |
AA Sequence : | DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name : | IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ] |
Official Symbol : | IGF2 |
Synonyms : | IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066; |
Gene ID : | 3481 |
mRNA Refseq : | NM_000612 |
Protein Refseq : | NP_000603 |
UniProt ID : | P01344 |
Chromosome Location : | 11p15.5 |
Pathway : | Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; |
Function : | growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; protein serine/threonine kinase activator activity; receptor activator activity; |
Products Types
◆ Recombinant Protein | ||
IGF2-987C | Recombinant Chicken IGF2 Protein, His-tagged | +Inquiry |
IGF2-1220H | Recombinant Human IGF2 Protein (30-180 aa), GST-tagged | +Inquiry |
IGF2-559H | Recombinant Human IGF2 Protein, Fc-tagged | +Inquiry |
Igf2-130M | Recombinant Active Mouse IGF2 Protein, His-tagged(N-ter) | +Inquiry |
IGF2-373I | Active Recombinant Human IGF2 Protein (68 aa) | +Inquiry |
◆ Native Protein | ||
IGF2-29116TH | Native Human IGF2 | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
◆ Lysates | ||
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket