Recombinant Human IKBKB
Cat.No. : | IKBKB-28877TH |
Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
Protein length : | 256 amino acids |
Molecular Weight : | 53.790kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in heart, placenta, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis and peripheral blood. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
Sequence Similarities : | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.Contains 1 protein kinase domain. |
Gene Name : | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
Official Symbol : | IKBKB |
Synonyms : | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB; |
Gene ID : | 3551 |
mRNA Refseq : | NM_001190720 |
Protein Refseq : | NP_001177649 |
MIM : | 603258 |
Uniprot ID : | O14920 |
Chromosome Location : | 8p11.2 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
Function : | ATP binding; IkappaB kinase activity; nucleotide binding; protein binding; protein kinase activity; |
Products Types
◆ Recombinant Protein | ||
Ikbkb-1232M | Recombinant Mouse Ikbkb Protein, MYC/DDK-tagged | +Inquiry |
IKBKB-1064H | Recombinant Human IKBKB Protein (S695-S756), Tag Free | +Inquiry |
IKBKB-2046R | Recombinant Rhesus Macaque IKBKB Protein, His (Fc)-Avi-tagged | +Inquiry |
IKBKB-501H | Recombinant Human IKBKB Protein, MYC/DDK-tagged | +Inquiry |
IKBKB-1162H | Recombinant Human IKBKB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket