Recombinant Human KAL1
Cat.No. : | KAL1-29684TH |
Product Overview : | Recombinant fragment of Human KAL1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQV TWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPS TLYRLEVQVLTPGGEGPATIKTFRTPELPP |
Sequence Similarities : | Contains 4 fibronectin type-III domains.Contains 1 WAP domain. |
Gene Name : | KAL1 Kallmann syndrome 1 sequence [ Homo sapiens ] |
Official Symbol : | KAL1 |
Synonyms : | KAL1; Kallmann syndrome 1 sequence; ADMLX, KAL; anosmin-1; anosmin 1; KALIG 1; |
Gene ID : | 3730 |
mRNA Refseq : | NM_000216 |
Protein Refseq : | NP_000207 |
MIM : | 300836 |
Uniprot ID : | P23352 |
Chromosome Location : | Xp22.32 |
Function : | extracellular matrix structural constituent; heparin binding; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
KAL1-5256H | Recombinant Human KAL1 Protein, His-tagged | +Inquiry |
KAL1-6975C | Recombinant Chicken KAL1 | +Inquiry |
◆ Lysates | ||
KAL1-5093HCL | Recombinant Human KAL1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket