Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human KAL1

Cat.No. : KAL1-29684TH
Product Overview : Recombinant fragment of Human KAL1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQV TWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPS TLYRLEVQVLTPGGEGPATIKTFRTPELPP
Sequence Similarities : Contains 4 fibronectin type-III domains.Contains 1 WAP domain.
Gene Name : KAL1 Kallmann syndrome 1 sequence [ Homo sapiens ]
Official Symbol : KAL1
Synonyms : KAL1; Kallmann syndrome 1 sequence; ADMLX, KAL; anosmin-1; anosmin 1; KALIG 1;
Gene ID : 3730
mRNA Refseq : NM_000216
Protein Refseq : NP_000207
MIM : 300836
Uniprot ID : P23352
Chromosome Location : Xp22.32
Function : extracellular matrix structural constituent; heparin binding; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends