Recombinant Human LPL, FLAG-tagged
Cat.No. : | LPL-27722TH |
Product Overview : | Recombinant Full length Human Lipoprotein lipase with an N terminal DDDDK tag; 461 amino acids, MWt 51.8kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism. |
Protein length : | 448 amino acids |
Conjugation : | FLAG |
Molecular Weight : | 51.800kDa inclusive of tags |
Source : | HEK 293 cells |
Form : | Lyophilised:Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term sto |
Purity : | Densitometry |
Storage buffer : | pH: 7.50Constituents:0.24% Tris buffer, 0.29% Sodium chloride |
Storage : | Store at -80°C |
Sequences of amino acids : | HVDYKDDDDKPAGADQRRDFIDIESKFALRTPEDTAEDTC HLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPK LVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQD VARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNK KVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTR GSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAE RGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSK EAFEKGLCLSCRKNRCNNLGYEISKVRAKRSSKMYLKTRS QMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESE NIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSY FSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQ KGKAPAVFVKCHDKSLNKKSG |
Sequence Similarities : | Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain. |
Gene Name : | LPL lipoprotein lipase [ Homo sapiens ] |
Official Symbol : | LPL |
Synonyms : | LPL; lipoprotein lipase; LIPD; |
Gene ID : | 4023 |
mRNA Refseq : | NM_000237 |
Protein Refseq : | NP_000228 |
Uniprot ID : | P06858 |
Chromosome Location : | 8p22 |
Pathway : | Adipogenesis, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function : | heparin binding; hydrolase activity; lipoprotein lipase activity; lipoprotein lipase activity; lipoprotein lipase activity; |
Products Types
◆ Recombinant Protein | ||
LPL-22H | Active Recombinant Human LPL Protein, His-tagged | +Inquiry |
LPL-4715H | Recombinant Human LPL Protein, GST-tagged | +Inquiry |
LPL-1312H | Recombinant Human LPL Protein, His (Fc)-Avi-tagged | +Inquiry |
LPL-404C | Recombinant Cynomolgus Monkey LPL Protein, His (Fc)-Avi-tagged | +Inquiry |
LPL-2403H | Recombinant Human LPL Protein, His-tagged | +Inquiry |
◆ Lysates | ||
LPL-4665HCL | Recombinant Human LPL 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-0521 | Lipoprotein Lipase Activity Fluorometric Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All LPL Products
Required fields are marked with *
My Review for All LPL Products
Required fields are marked with *
0
Inquiry Basket