Recombinant Human LSAMP
Cat.No. : | LSAMP-29434TH |
Product Overview : | Recombinant full length protein of Human LSAMP with a N terminal proprietary tag; Predicted MWt 59.62kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. |
Protein length : | 310 amino acids |
Molecular Weight : | 59.620kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRS GIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGS YTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSN VTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGIT REQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNE ATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKS TEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRP GSVRGINGSISLAVPLWLLAASLLCLLSKC |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. IgLON family.Contains 3 Ig-like C2-type (immunoglobulin-like) domains. |
Gene Name : | LSAMP limbic system-associated membrane protein [ Homo sapiens ] |
Official Symbol : | LSAMP |
Synonyms : | LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP; |
Gene ID : | 4045 |
mRNA Refseq : | NM_002338 |
Protein Refseq : | NP_002329 |
MIM : | 603241 |
Uniprot ID : | Q13449 |
Chromosome Location : | 3q13.2-q21 |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
LSAMP-972H | Recombinant Human LSAMP Protein, MYC/DDK-tagged | +Inquiry |
Lsamp-3850M | Recombinant Mouse Lsamp Protein, Myc/DDK-tagged | +Inquiry |
LSAMP-5222M | Recombinant Mouse LSAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
LSAMP-3149R | Recombinant Rat LSAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
LSAMP-4620H | Recombinant Human LSAMP Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket