Recombinant Human MBNL1
Cat.No. : | MBNL1-30258TH |
Product Overview : | Recombinant full length Human Muscleblind-like 1 according to AAH50535,with N-terminal proprietary tag.Mol Wt 63.84 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Muscleblind-like (Drosophila), also known as MBNL1, is a protein that in humans is encoded by the MBNL1 gene. It has been implicated in Myotonic dystrophy and has been shown to autoregulate its transcript. |
Protein length : | 343 amino acids |
Molecular Weight : | 63.840kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in cardiac, skeletal muscle and during myoblast differentiation. Weakly expressed in other tissues (at protein level). Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLA QQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYL GPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLM RTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNT VTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQA AAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPL PKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLP PGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAAT ATANQIPIISAEHLTSHKYVTQM |
Sequence Similarities : | Belongs to the muscleblind family.Contains 4 C3H1-type zinc fingers. |
Gene Name : | MBNL1 muscleblind-like (Drosophila) [ Homo sapiens ] |
Official Symbol : | MBNL1 |
Synonyms : | MBNL1; muscleblind-like (Drosophila); MBNL, muscleblind (Drosophila) like; muscleblind-like protein 1; EXP; EXP35; EXP40; EXP42; KIAA0428; |
Gene ID : | 4154 |
mRNA Refseq : | NM_207294 |
Protein Refseq : | NP_997177 |
MIM : | 606516 |
Uniprot ID : | Q9NR56 |
Chromosome Location : | 3q25 |
Pathway : | Adipogenesis, organism-specific biosystem; |
Function : | RNA binding; double-stranded RNA binding; metal ion binding; nucleic acid binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
MBNL1-241H | Recombinant Human MBNL1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mbnl1-3982M | Recombinant Mouse Mbnl1 Protein, Myc/DDK-tagged | +Inquiry |
MBNL1-524H | Recombinant Human MBNL1 protein, MYC/DDK-tagged | +Inquiry |
MBNL1-4523Z | Recombinant Zebrafish MBNL1 | +Inquiry |
MBNL1-2736H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
MBNL1-4441HCL | Recombinant Human MBNL1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket