Recombinant Human MEOX2
Cat.No. : | MEOX2-29604TH |
Product Overview : | Recombinant full length Human MEOX 2 with N terminal proprietary tag, 59.07 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimers disease. |
Protein length : | 303 amino acids |
Molecular Weight : | 59.070kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Embryo and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPE LSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQ QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEK RSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQ QTGDSIANEDSHDSDHSSEHAHL |
Sequence Similarities : | Contains 1 homeobox DNA-binding domain. |
Gene Name : | MEOX2 mesenchyme homeobox 2 [ Homo sapiens ] |
Official Symbol : | MEOX2 |
Synonyms : | MEOX2; mesenchyme homeobox 2; GAX, mesenchyme homeo box 2 (growth arrest specific homeo box) , mesenchyme homeobox 2 (growth arrest specific homeo box); homeobox protein MOX-2; growth arrest specific homeobox; MOX2; |
Gene ID : | 4223 |
mRNA Refseq : | NM_005924 |
Protein Refseq : | NP_005915 |
MIM : | 600535 |
Uniprot ID : | P50222 |
Chromosome Location : | 7p22.1-p21.3 |
Function : | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
MEOX2-3303R | Recombinant Rat MEOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEOX2-4440H | Recombinant Human MEOX2 Protein, GST-tagged | +Inquiry |
MEOX2-5477M | Recombinant Mouse MEOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEOX2-240H | Recombinant Human mesenchyme homeobox 2, His-tagged | +Inquiry |
MEOX2-3647R | Recombinant Rat MEOX2 Protein | +Inquiry |
◆ Lysates | ||
MEOX2-4365HCL | Recombinant Human MEOX2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket