Recombinant Human MFSD8 Protein (1-40 aa), His-GST-tagged
Cat.No. : | MFSD8-2165H |
Product Overview : | Recombinant Human MFSD8 Protein (1-40 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Description : | May be a carrier that transport small solutes by using chemiosmotic ion gradients. |
Source : | E. coli |
Species : | Human |
Tag : | His-GST |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.8 kDa |
Protein length : | 1-40 aa |
AA Sequence : | MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name : | MFSD8 major facilitator superfamily domain containing 8 [ Homo sapiens ] |
Official Symbol : | MFSD8 |
Synonyms : | MFSD8; MGC33302; CLN7; |
Gene ID : | 256471 |
mRNA Refseq : | NM_152778 |
Protein Refseq : | NP_689991 |
MIM : | 611124 |
UniProt ID : | Q8NHS3 |
Products Types
◆ Recombinant Protein | ||
MFSD8-3470H | Recombinant Human MFSD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFSD8-5529M | Recombinant Mouse MFSD8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFSD8-4372H | Recombinant Human MFSD8 Protein | +Inquiry |
MFSD8-1039H | Recombinant Human MFSD8 | +Inquiry |
MFSD8-4111Z | Recombinant Zebrafish MFSD8 | +Inquiry |
◆ Lysates | ||
MFSD8-4344HCL | Recombinant Human MFSD8 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MFSD8 Products
Required fields are marked with *
My Review for All MFSD8 Products
Required fields are marked with *
0
Inquiry Basket