Description : |
MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Alternative splicing results in multiple transcript variants. |
Protein length : |
283 amino acids |
Source : |
E. coli |
Tissue specificity : |
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassals corpuscles within th |
Form : |
Lyophilised:Lyophilized from a concentrated (1mg/ml) solution, reconstitute the lyophilized MICA in sterile 18MO-cm water not less than 100μg/ml, which can then be further diluted to other aqueous solutions. |
Purity : |
>95% by SDS-PAGE |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : |
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQK CRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLA HIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGEL FLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTK THYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSE ASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGD VLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTH PVPSGKVLVLQSH. |
Sequence Similarities : |
Belongs to the MHC class I family. MIC subfamily.Contains 1 Ig-like C1-type (immunoglobulin-like) domain. |