Recombinant Human MMP1 protein, His-tagged
Cat.No. : | MMP1-2983H |
Product Overview : | Recombinant Human MMP1 protein(428-469 aa), fused to His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein length : | 428-469 aa |
AA Sequence : | AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens ] |
Official Symbol : | MMP1 |
Synonyms : | MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN; |
Gene ID : | 4312 |
mRNA Refseq : | NM_001145938 |
Protein Refseq : | NP_001139410 |
MIM : | 120353 |
UniProt ID : | P03956 |
Products Types
◆ Recombinant Protein | ||
MMP1-1116P | Recombinant Pig MMP1 Protein, His-tagged | +Inquiry |
MMP1-5412H | Active Recombinant Human MMP1 Protein | +Inquiry |
MMP1-1115R | Recombinant Rabbit MMP1 Protein, His-tagged | +Inquiry |
MMP1-4450H | Recombinant Human MMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP1-2536H | Recombinant Human MMP1 protein(20-469 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Native Protein | ||
MMP1-45H | Native Human MMP-1 | +Inquiry |
◆ Lysates | ||
MMP1-2884HCL | Recombinant Human MMP1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket