Recombinant Human MPZ
Cat.No. : | MPZ-29152TH |
Product Overview : | Recombinant full length Human Myelin Protein Zero protein with an N terminal proprietary tag; predicted mwt: 54.12 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 and other polyneuropathies. |
Protein length : | 258 amino acids |
Molecular Weight : | 54.120kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Found only in peripheral nervous system Schwann cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAI VVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQP EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKV PTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAAL QRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK AVSEKKAKGLGESRKDKK |
Sequence Similarities : | Belongs to the myelin P0 protein family.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name : | MPZ myelin protein zero [ Homo sapiens ] |
Official Symbol : | MPZ |
Synonyms : | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; |
Gene ID : | 4359 |
mRNA Refseq : | NM_000530 |
Protein Refseq : | NP_000521 |
MIM : | 159440 |
Uniprot ID : | P25189 |
Chromosome Location : | 1q22 |
Pathway : | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function : | structural molecule activity; |
Products Types
◆ Recombinant Protein | ||
MPZ-1218H | Recombinant Human MPZ Protein (30-156 aa), GST-tagged | +Inquiry |
MPZ-3402R | Recombinant Rat MPZ Protein, His (Fc)-Avi-tagged | +Inquiry |
Mpz-4131M | Recombinant Mouse Mpz Protein, Myc/DDK-tagged | +Inquiry |
MPZ-1461H | Recombinant Human MPZ Protein (30-156 aa), His-tagged | +Inquiry |
Mpz-1791R | Recombinant Rat Mpz Protein, His&GST-tagged | +Inquiry |
◆ Lysates | ||
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
0
Inquiry Basket