Recombinant Human MSX2

• Cat.No.: MSX2-29500TH
• Product Overview: Recombinant fragment of Human Msx2/Hox8 with N terminal proprietary tag, predicted mwt: 40.26 kDa.

Specification

• Description: This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2.
• Protein length: 133 amino acids
• Molecular Weight: 40.260kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRV KVSSLPFSVEALMSDKKPPKEASPLPAESASAGATLRPLL LSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG RYSPPPRHTSPTT
• Sequence Similarities: Belongs to the Msh homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: MSX2 msh homeobox 2 [ Homo sapiens ]
• Official Symbol: MSX2
• Synonyms: MSX2; msh homeobox 2; msh (Drosophila) homeo box homolog 2 , msh homeobox homolog 2 (Drosophila) , parietal foramina 1 , PFM1; homeobox protein MSX-2; craniosynostosis; type 2; CRS2; FPP; HOX8; MSH; PFM
• Gene ID: 4488
• mRNA Refseq: NM_002449
• Protein Refseq: NP_002440
• MIM: 123101
• Uniprot ID: P35548
• Chromosome Location: 5q35.2
• Pathway: HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcription regulatory region DNA binding