Recombinant Human MT1X protein, GST-tagged
Cat.No. : | MT1X-1302H |
Product Overview : | Recombinant Human MT1X protein(NP_005943)(1-46 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Protein length : | 1-46 aa |
AA Sequence : | MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSECRAFPANLGDGPI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name : | MT1X metallothionein 1X [ Homo sapiens (human) ] |
Official Symbol : | MT1X |
Synonyms : | MT1; MT-1l |
Gene ID : | 4501 |
mRNA Refseq : | NM_005952.4 |
Protein Refseq : | NP_005943 |
MIM : | 156359 |
UniProt ID : | P80297 |
Products Types
◆ Recombinant Protein | ||
MT1X-130H | Recombinant Human MT1X Protein, His-tagged | +Inquiry |
MT1X-2707R | Recombinant Rhesus Macaque MT1X Protein, His (Fc)-Avi-tagged | +Inquiry |
MT1X-3534H | Recombinant Human MT1X Protein, His (Fc)-Avi-tagged | +Inquiry |
MT1X-1301H | Recombinant Human MT1X Protein (1-59 aa), GST-tagged | +Inquiry |
MT1X-2887R | Recombinant Rhesus monkey MT1X Protein, His-tagged | +Inquiry |
◆ Lysates | ||
MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MT1X Products
Required fields are marked with *
My Review for All MT1X Products
Required fields are marked with *
0
Inquiry Basket