Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MTMR1 Protein, GST-tagged

Cat.No. : MTMR1-5711H
Product Overview : Human MTMR1 full-length ORF ( AAH11250, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 29.92 kDa
AA Sequence : MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : MTMR1 myotubularin related protein 1 [ Homo sapiens ]
Official Symbol : MTMR1
Synonyms : MTMR1; myotubularin related protein 1; myotubularin-related protein 1;
Gene ID : 8776
mRNA Refseq : NM_003828
Protein Refseq : NP_003819
MIM : 300171
UniProt ID : Q13613

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends