Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MYBL1

Cat.No. : MYBL1-29831TH
Product Overview : Recombinant fragment of Human v-Myb with N terminal proprietary tag; Predicted MW 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in a variety of lymphoid and solid tumor lines cultured in vitro.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPL LEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVK LEKNLQSNCEWETVVYGKTEDQLIMTEQAR
Sequence Similarities : Contains 3 HTH myb-type DNA-binding domains.
Gene Name : MYBL1 v-myb myeloblastosis viral oncogene homolog (avian)-like 1 [ Homo sapiens ]
Official Symbol : MYBL1
Synonyms : MYBL1; v-myb myeloblastosis viral oncogene homolog (avian)-like 1; v myb avian myeloblastosis viral oncogene homolog like 1; myb-related protein A; A myb; AMYB;
Gene ID : 4603
mRNA Refseq : NM_001080416
Protein Refseq : NP_001073885
MIM : 159405
Uniprot ID : P10243
Chromosome Location : 8q22
Pathway : HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; IL4-mediated signaling events, organism-specific biosystem;
Function : DNA binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MYBL1 Products

Required fields are marked with *

My Review for All MYBL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends