Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MYL4, His-tagged

Cat.No. : MYL4-30265TH
Product Overview : Recombinant full length Human MYL4 (amino acids 1-197) with a C terminal His tag; 205aa, 22.6kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein length : 197 amino acids
Conjugation : HIS
Molecular Weight : 22.600kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFD PKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGD VLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLA TLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSGLEH HHHHH
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name : MYL4 myosin, light chain 4, alkali; atrial, embryonic [ Homo sapiens ]
Official Symbol : MYL4
Synonyms : MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957;
Gene ID : 4635
mRNA Refseq : NM_001002841
Protein Refseq : NP_001002841
MIM : 160770
Uniprot ID : P12829
Chromosome Location : 17q21-qter
Pathway : Muscle contraction, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem;
Function : actin filament binding; actin monomer binding; calcium ion binding; myosin II heavy chain binding; structural constituent of muscle;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends