Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MYL6

Cat.No. : MYL6-30267TH
Product Overview : Recombinant full length Human MYL6 expressed in Saccharomyces cerevisiae; amino acids 1-151, 151 amino acids, MWt 16.9kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALG QNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVA KNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTL GEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name : MYL6 myosin, light chain 6, alkali, smooth muscle and non-muscle [ Homo sapiens ]
Official Symbol : MYL6
Synonyms : MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM;
Gene ID : 4637
mRNA Refseq : NM_021019
Protein Refseq : NP_066299
MIM : 609931
Uniprot ID : P60660
Chromosome Location : 12q13.13
Pathway : Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Muscle contraction, organism-specific biosystem; Sema4D in semaphorin signaling, organism-specific biosystem;
Function : actin-dependent ATPase activity; calcium ion binding; motor activity; protein binding; structural constituent of muscle;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends