Recombinant Human NDC80, His-tagged
Cat.No. : | NDC80-27986TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 350-642 of Human HEC1 with N terminal His tag; MWt 37 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEA EQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPK GAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELL NETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTL KEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLE STVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNN LQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDL SENIKEIRDKYEKKATLIKSSEE |
Sequence Similarities : | Belongs to the NDC80/HEC1 family. |
Gene Name : | NDC80 NDC80 homolog, kinetochore complex component (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | NDC80 |
Synonyms : | NDC80; NDC80 homolog, kinetochore complex component (S. cerevisiae); highly expressed in cancer, rich in leucine heptad repeats (yeast) , kinetochore associated 2 , KNTC2; kinetochore protein NDC80 homolog; HEC; HEC1; hsNDC80; TID3; |
Gene ID : | 10403 |
mRNA Refseq : | NM_006101 |
Protein Refseq : | NP_006092 |
MIM : | 607272 |
Uniprot ID : | O14777 |
Chromosome Location : | 18p11.31 |
Pathway : | Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
NDC80-2782R | Recombinant Rhesus Macaque NDC80 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDC80-5949M | Recombinant Mouse NDC80 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDC80-4899H | Recombinant Human NDC80 Protein, GST-tagged | +Inquiry |
NDC80-474C | Recombinant Cynomolgus Monkey NDC80 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDC80-6047C | Recombinant Chicken NDC80 | +Inquiry |
◆ Lysates | ||
NDC80-952HCL | Recombinant Human NDC80 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket