Recombinant Human NDUFB10, His-tagged
Cat.No. : | NDUFB10-28708TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-172 of Human NDUFB10 with N terminal His tag. Predicted mwt: 22 kDa; |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVT LVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMC MYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQ QNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQR MLQERKAAKEAAAATS |
Sequence Similarities : | Belongs to the complex I NDUFB10 subunit family. |
Gene Name : | NDUFB10 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa [ Homo sapiens ] |
Official Symbol : | NDUFB10 |
Synonyms : | NDUFB10; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; complex I PDSW subunit; PDSW; |
Gene ID : | 4716 |
mRNA Refseq : | NM_004548 |
Protein Refseq : | NP_004539 |
MIM : | 603843 |
Uniprot ID : | O96000 |
Chromosome Location : | 16p13.3 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function : | NADH dehydrogenase (ubiquinone) activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
NDUFB10-5978M | Recombinant Mouse NDUFB10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFB10-10529M | Recombinant Mouse NDUFB10 Protein | +Inquiry |
NDUFB10-3269H | Recombinant Human NDUFB10 protein, GST-tagged | +Inquiry |
NDUFB10-10993Z | Recombinant Zebrafish NDUFB10 | +Inquiry |
NDUFB10-131H | Recombinant Human NDUFB10 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
NDUFB10-3909HCL | Recombinant Human NDUFB10 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket