Recombinant Human NFYB
Cat.No. : | NFYB-29919TH |
Product Overview : | Recombinant full length Human NFYB with a N terminal proprietary tag; Predicted MWt 48.51 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. |
Protein length : | 207 amino acids |
Molecular Weight : | 48.510kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS |
Sequence Similarities : | Belongs to the NFYB/HAP3 subunit family. |
Gene Name : | NFYB nuclear transcription factor Y, beta [ Homo sapiens ] |
Official Symbol : | NFYB |
Synonyms : | NFYB; nuclear transcription factor Y, beta; nuclear transcription factor Y subunit beta; CBF A; HAP3; NF YB; |
Gene ID : | 4801 |
mRNA Refseq : | NM_006166 |
Protein Refseq : | NP_006157 |
MIM : | 189904 |
Uniprot ID : | P25208 |
Chromosome Location : | 12q22-q23 |
Pathway : | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; |
Function : | DNA binding; protein binding; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
NFYB-2839R | Recombinant Rhesus Macaque NFYB Protein, His (Fc)-Avi-tagged | +Inquiry |
NFYB-2134H | Recombinant Human NFYB Protein (1-207 aa), GST-tagged | +Inquiry |
NFYB-6046M | Recombinant Mouse NFYB Protein, His (Fc)-Avi-tagged | +Inquiry |
NFYB-3637R | Recombinant Rat NFYB Protein, His (Fc)-Avi-tagged | +Inquiry |
NFYB-224H | Recombinant Human NFYB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Lysates | ||
NFYB-3839HCL | Recombinant Human NFYB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket