Recombinant Human NPM1
Cat.No. : | NPM1-27765TH |
Product Overview : | Recombinant full length Human Nucleophosmin with N terminal proprietary tag, 58.45kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. |
Protein length : | 295 amino acids |
Molecular Weight : | 58.450kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEH QLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK MSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAA DEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTP AKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD QEAIQDLWQWRKSL |
Sequence Similarities : | Belongs to the nucleoplasmin family. |
Gene Name : | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
Official Symbol : | NPM1 |
Synonyms : | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; |
Gene ID : | 4869 |
mRNA Refseq : | NM_001037738 |
Protein Refseq : | NP_001032827 |
MIM : | 164040 |
Uniprot ID : | P06748 |
Chromosome Location : | 5q35.1 |
Pathway : | Aurora B signaling, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; |
Function : | NF-kappaB binding; NF-kappaB binding; RNA binding; Tat protein binding; histone binding; |
Products Types
◆ Recombinant Protein | ||
NPM1-6037H | Recombinant Human NPM1 Protein, GST-tagged | +Inquiry |
Npm1-1297M | Recombinant Mouse Npm1 Protein, His-SUMO-tagged | +Inquiry |
NPM1-231H | Recombinant Human NPM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPM1-181H | Recombinant Human NPM1 protein(Glu2-Leu294), His-tagged | +Inquiry |
NPM1-3805H | Recombinant Human NPM1 protein(Met9-Leu158), His-tagged | +Inquiry |
◆ Lysates | ||
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket