Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human OR2H1 protein, GST-tagged

Cat.No. : OR2H1-301249H
Product Overview : Recombinant Human OR2H1 (128-170 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Leu128-Gln170
AA Sequence : LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name : OR2H1 olfactory receptor, family 2, subfamily H, member 1 [ Homo sapiens ]
Official Symbol : OR2H1
Synonyms : OR2H1; olfactory receptor, family 2, subfamily H, member 1; olfactory receptor, family 2, subfamily H, member 8 , OR2H6, OR2H8; olfactory receptor 2H1; OR6 2; OLFR42A-9004.14/9026.2; olfactory receptor 2H6; olfactory receptor 2H8; olfactory receptor 6-2; olfactory receptor OR6-32; olfactory receptor, family 2, subfamily H, member 6; olfactory receptor, family 2, subfamily H, member 8; OR2H6; OR2H8; OR6-2; 6M1-16; HS6M1-16; dJ994E9.4; OLFR42A-9004-14;
Gene ID : 26716
mRNA Refseq : NM_030883
Protein Refseq : NP_112145
UniProt ID : Q9GZK4

Products Types

◆ Lysates
OR2H1-3563HCL Recombinant Human OR2H1 293 Cell Lysate +Inquiry

See All OR2H1 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends