Recombinant Human OR2H1 protein, GST-tagged
Cat.No. : | OR2H1-301249H |
Product Overview : | Recombinant Human OR2H1 (128-170 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Leu128-Gln170 |
AA Sequence : | LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | OR2H1 olfactory receptor, family 2, subfamily H, member 1 [ Homo sapiens ] |
Official Symbol : | OR2H1 |
Synonyms : | OR2H1; olfactory receptor, family 2, subfamily H, member 1; olfactory receptor, family 2, subfamily H, member 8 , OR2H6, OR2H8; olfactory receptor 2H1; OR6 2; OLFR42A-9004.14/9026.2; olfactory receptor 2H6; olfactory receptor 2H8; olfactory receptor 6-2; olfactory receptor OR6-32; olfactory receptor, family 2, subfamily H, member 6; olfactory receptor, family 2, subfamily H, member 8; OR2H6; OR2H8; OR6-2; 6M1-16; HS6M1-16; dJ994E9.4; OLFR42A-9004-14; |
Gene ID : | 26716 |
mRNA Refseq : | NM_030883 |
Protein Refseq : | NP_112145 |
UniProt ID : | Q9GZK4 |
Products Types
◆ Lysates | ||
OR2H1-3563HCL | Recombinant Human OR2H1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket