Recombinant Human OSTF1, His-tagged
Cat.No. : | OSTF1-28124TH |
Product Overview : | Recombinant full length Human OSTF1 with C terminal His tag; 222 amino acids with a predicted MWt 25.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
Description : | Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al. |
Protein length : | 214 amino acids |
Conjugation : | HIS |
Molecular Weight : | 25.100kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Ubiquitously expressed. Present in osteoclasts (at protein level). |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 0.01% DTT, 10% Glycerol |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELYFEEGD IIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPL HEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGG HKDIVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQ LFLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDA VRTLSNAEDYLDDEDSDLEHHHHHH |
Sequence Similarities : | Contains 3 ANK repeats.Contains 1 SH3 domain. |
Gene Name : | OSTF1 osteoclast stimulating factor 1 [ Homo sapiens ] |
Official Symbol : | OSTF1 |
Synonyms : | OSTF1; osteoclast stimulating factor 1; osteoclast-stimulating factor 1; bA235O14.1; OSF; SH3P2; |
Gene ID : | 26578 |
mRNA Refseq : | NM_012383 |
Protein Refseq : | NP_036515 |
MIM : | 610180 |
Uniprot ID : | Q92882 |
Chromosome Location : | 9q13-q21.2 |
Function : | SH3 domain binding; |
Products Types
◆ Recombinant Protein | ||
OSTF1-6422M | Recombinant Mouse OSTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OSTF1-3875R | Recombinant Rat OSTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ostf1-4620M | Recombinant Mouse Ostf1 Protein, Myc/DDK-tagged | +Inquiry |
OSTF1-1474H | Recombinant Human OSTF1, GST-tagged | +Inquiry |
OSTF1-4188H | Recombinant Human OSTF1 Protein (Gly12-Asp214), N-His tagged | +Inquiry |
◆ Lysates | ||
OSTF1-3520HCL | Recombinant Human OSTF1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket