Recombinant Human OTOR
Cat.No. : | OTOR-28850TH |
Product Overview : | Recombinant full length Human Otoraplin ; 111 amino acids, predicted MWt 12.7 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene. |
Protein length : | 111 amino acids |
Molecular Weight : | 12.700kDa |
Source : | E. coli |
Tissue specificity : | Highly expressed in cochlea. |
Form : | Lyophilised:Reconstitute the lyophilized Otoraplin in 50ul sterile ultra pure. |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 7.40Constituents:0.19% PBS, 0.75% Sodium chloride |
Storage : | Please see Notes section |
Sequences of amino acids : | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRF INVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVV GYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
Sequence Similarities : | Belongs to the MIA/OTOR family.Contains 1 SH3 domain. |
Gene Name : | OTOR otoraplin [ Homo sapiens ] |
Official Symbol : | OTOR |
Synonyms : | OTOR; otoraplin; FDP; MIAL; MIAL1; |
Gene ID : | 56914 |
mRNA Refseq : | NM_020157 |
Protein Refseq : | NP_064542 |
MIM : | 606067 |
Uniprot ID : | Q9NRC9 |
Chromosome Location : | 20p12.1-p11.23 |
Products Types
◆ Recombinant Protein | ||
Otor-4623M | Recombinant Mouse Otor Protein, Myc/DDK-tagged | +Inquiry |
OTOR-210O | Recombinant Human OTOR Protein (111 aa) | +Inquiry |
OTOR-063O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
OTOR-318O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
OTOR-6297C | Recombinant Chicken OTOR | +Inquiry |
◆ Lysates | ||
OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket