Recombinant Human PARK7
Cat.No. : | PARK7-30783TH |
Product Overview : | Recombinant Full Length Human PARK7/DJ1 expressed in Saccharomyces cerevisiae; amino acids 1-189; 189 amino acids, MWt 19.9 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
Description : | The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. |
Tissue specificity : | Highly expressed in pancreas, kidney, skeletal muscle, liver, testis and heart. Detected at slightly lower levels in placenta and brain. Detected in astrocytes, Sertoli cells, spermatogonia, spermatids and spermatozoa. |
Biological activity : | This protein contains a proprietary tag (26 kDa) and the whole proteins MW is around 45KD. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAG KDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLG AQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHE IGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD |
Sequence Similarities : | Belongs to the peptidase C56 family. |
Gene Name : | PARK7 parkinson protein 7 [ Homo sapiens ] |
Official Symbol : | PARK7 |
Synonyms : | PARK7; parkinson protein 7; Parkinson disease (autosomal recessive, early onset) 7; protein DJ-1; DJ 1; DJ1; |
Gene ID : | 11315 |
mRNA Refseq : | NM_001123377 |
Protein Refseq : | NP_001116849 |
MIM : | 602533 |
Uniprot ID : | Q99497 |
Chromosome Location : | 1p36.23 |
Pathway : | Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem; |
Function : | mRNA binding; peptidase activity; peroxidase activity; peroxiredoxin activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
PARK7-6498M | Recombinant Mouse PARK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARK7-3936R | Recombinant Rat PARK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
PARK7-2549H | Recombinant Human PARK7 Protein, His-tagged | +Inquiry |
Park7-4676M | Recombinant Mouse Park7 Protein, Myc/DDK-tagged | +Inquiry |
Park7-1900M | Recombinant Mouse Park7 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PARK7-3432HCL | Recombinant Human PARK7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket