Recombinant Human POMGNT1, His-tagged
Cat.No. : | POMGNT1-27934TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 408-660 of Human POMGNT1 with N terminal His tag; 42 kDa ; |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a type II transmembrane protein that resides in the golgi. It participates in O-mannosyl glycosylation, and is specific for alpha linked terminal mannose. Mutations in this gene are associated with muscle-eye-brain (MEB) disease. Alternatively spliced transcript variants have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Constitutively expressed. An additional weaker band is also detected in spinal cord, lymph node, and trachea. Expressed especially in astrocytes. Also expressed in immature and mature neurons. |
Form : | Lyophilised:Reconstitute with 32 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMP GLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQR RGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFN TVPGVQLRNVDSLKKEAYEVEVHRLLSEAEVLDHSKNP CEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIWD LDVRGNHRGLWRLFRKKNHFLVVGVPASPYSVKKPPSV TPIFLEPPPKEEGAPGAPEQT |
Sequence Similarities : | Belongs to the glycosyltransferase 13 family. |
Gene Name : | POMGNT1 protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase [ Homo sapiens ] |
Official Symbol : | POMGNT1 |
Synonyms : | POMGNT1; protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase; protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; FLJ20277; MGAT1.2; protein O mannose beta 1; 2 N acetylglucosaminyltransferase; |
Gene ID : | 55624 |
mRNA Refseq : | NM_001243766 |
Protein Refseq : | NP_001230695 |
MIM : | 606822 |
Uniprot ID : | Q8WZA1 |
Chromosome Location : | 1p34.1 |
Pathway : | Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem; |
Function : | alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups; |
Products Types
◆ Recombinant Protein | ||
POMGNT1-4235R | Recombinant Rat POMGNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POMGNT1-6937M | Recombinant Mouse POMGNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POMGNT1-4575R | Recombinant Rat POMGNT1 Protein | +Inquiry |
POMGNT1-289H | Active Recombinant Human POMGNT1, His-tagged | +Inquiry |
POMGNT1-4975H | Recombinant Human POMGNT1 Protein (Leu59-Thr660), C-His tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket