Recombinant Human POTEH protein, GST-tagged
Cat.No. : | POTEH-301256H |
Product Overview : | Recombinant Human POTEH (24-59 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met24-Ser59 |
AA Sequence : | MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | POTEH POTE ankyrin domain family, member H [ Homo sapiens ] |
Official Symbol : | POTEH |
Synonyms : | POTEH; POTE ankyrin domain family, member H; A26C3, ACTBL1, actin, beta like 1 , ANKRD26 like family C, member 3; POTE ankyrin domain family member H; cancer/testis antigen family 104; member 7; CT104.7; POTE22; POTE-22; actin, beta-like 1; ANKRD26-like family C member 3; ANKRD26-like family C, member 3; cancer/testis antigen family 104, member 7; prostate, ovary, testis-expressed protein on chromosome 22; protein expressed in prostate, ovary, testis, and placenta 22; protein expressed in prostate, ovary, testis, and placenta POTE14 like; A26C3; ACTBL1; |
Gene ID : | 23784 |
mRNA Refseq : | NM_001136213 |
Protein Refseq : | NP_001129685 |
MIM : | 608913 |
UniProt ID : | Q6S545 |
Products Types
◆ Recombinant Protein | ||
POTEH-213H | Recombinant Human POTEH Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
POTEH-21HCL | Recombinant Human POTEH cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket