Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PPIF

Cat.No. : PPIF-27049TH
Product Overview : Recombinant full length human Cyclophilin F; 198 amino acids, 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris, 1mM DTT, pH 7.5
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVY LDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDEN FTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHV VFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Gene Name : PPIF peptidylprolyl isomerase F [ Homo sapiens ]
Official Symbol : PPIF
Synonyms : PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3;
Gene ID : 10105
mRNA Refseq : NM_005729
Protein Refseq : NP_005720
MIM : 604486
Uniprot ID : P30405
Chromosome Location : 10q22-q23
Pathway : Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem;
Function : cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PPIF Products

Required fields are marked with *

My Review for All PPIF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends