Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PPIH

Cat.No. : PPIH-30106TH
Product Overview : Recombinant full length human PPIH; 177 amino acids, 19.2kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTA ENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFV NGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG PNNKPKLPVVISQCGEM
Sequence Similarities : Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.Contains 1 PPIase cyclophilin-type domain.
Gene Name : PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ]
Official Symbol : PPIH
Synonyms : PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucl
Gene ID : 10465
mRNA Refseq : NM_006347
Protein Refseq : NP_006338
MIM : 606095
Uniprot ID : O43447
Chromosome Location : 1p34.1
Pathway : Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem;
Function : cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends