Recombinant Human PSMA5
Cat.No. : | PSMA5-29976TH |
Product Overview : | Recombinant fragment corresponding to amino acids 132-241 of Human Proteasome 20S alpha 5 with a N terminal proprietary tag, predicted MW: 37.73 kDa inclusive of tag. P28066, |
- Specification
- Gene Information
- Related Products
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in fetal brain (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIG SASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLN ATNIELATVQPGQNFHMFTKEELEEVIKDI |
Sequence Similarities : | Belongs to the peptidase T1A family. |
Gene Name : | PSMA5 proteasome (prosome, macropain) subunit, alpha type, 5 [ Homo sapiens ] |
Official Symbol : | PSMA5 |
Synonyms : | PSMA5; proteasome (prosome, macropain) subunit, alpha type, 5; proteasome subunit alpha type-5; ZETA; |
Gene ID : | 5686 |
mRNA Refseq : | NM_001199772 |
Protein Refseq : | NP_001186701 |
MIM : | 176844 |
Uniprot ID : | P28066 |
Chromosome Location : | 1p13 |
Pathway : | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function : | peptidase activity; protein binding; threonine-type endopeptidase activity; |
Products Types
◆ Recombinant Protein | ||
PSMA5-3058H | Recombinant Human PSMA5 Protein, MYC/DDK-tagged | +Inquiry |
PSMA5-3469R | Recombinant Rhesus Macaque PSMA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMA5-4426R | Recombinant Rat PSMA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMA5-414H | Recombinant Human PSMA5 Protein, His-tagged | +Inquiry |
Psma5-5175M | Recombinant Mouse Psma5 Protein, Myc/DDK-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket