Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PSMB9, His-tagged

Cat.No. : PSMB9-31103TH
Product Overview : Recombinant full length protein, corresponding to amino acids 6-209 of Human Proteasome 20S LMP2 with N terminal His tag; Predicted MWt 23 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLS PLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEP PLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQV YGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPE ECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVIL GNELPKFYDE
Sequence Similarities : Belongs to the peptidase T1B family.
Gene Name : PSMB9 proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) [ Homo sapiens ]
Official Symbol : PSMB9
Synonyms : PSMB9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); LMP2, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional protease 2); proteasome subunit beta type-9; beta1i; PSMB6i; RING12;
Gene ID : 5698
mRNA Refseq : NM_002800
Protein Refseq : NP_002791
MIM : 177045
Uniprot ID : P28065
Chromosome Location : 6p21.3
Pathway : APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function : peptidase activity; protein binding; threonine-type endopeptidase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends