Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PTDSS1 Protein (1-35 aa), GST-tagged

Cat.No. : PTDSS1-1203H
Product Overview : Recombinant Human PTDSS1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
Description : Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In mbranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.
Source : E. coli
Species : Human
Tag : GST
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.1 kDa
Protein length : 1-35 aa
AA Sequence : MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name : PTDSS1 phosphatidylserine synthase 1 [ Homo sapiens ]
Official Symbol : PTDSS1
Synonyms : PTDSS1; KIAA0024; PSS1; PSSA; PSS-1;
Gene ID : 9791
mRNA Refseq : NM_014754
Protein Refseq : NP_055569
MIM : 612792
UniProt ID : P48651

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends