Description : |
Parathyroid hormone (PTH) is a single polypeptide of 84 amino acids. PTH is a critical hormone in the regulation of Ca2+ homeostasis. PTH is secreted by the parathyroid glands, which promote release of calcium from bone to extracellular fluid by activating osteoblasts and inhibiting osteoclasts, indirectly promote increased intestinal absorption of calcium, and promote renal tubular reabsorption of calcium and increased renal excretion of phosphates. It is a major regulator of bone metabolism. Secretion of parathyroid hormone increases when the level of calcium in the extracellular fluid is low. The amino terminal (1-34) fragment of parathyroid hormone, called PTH (1-34)reproduces all the activity of the full length mature hormone and has been used therapeutically for treatment of osteoporosis. |
Source : |
E.coli |
Species : |
Human |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.0. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg. |
Molecular Mass : |
Approximately 4.1 kDa, a single non-glycosylated polypeptide chain containing 34 amino acids. |
Protein length : |
34 |
AA Sequence : |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Endotoxin : |
Less than 1 EU/µg of rHuPTH1-34 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Publication : |
Measurements of Osteoanabolic agents PTH (1-34) and PTHrP (1-36) in therapeutic studies and clinical diagnostics. (2017)
|